PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PSME_00035515-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Pseudotsuga
Family GRAS
Protein Properties Length: 760aa    MW: 84762.8 Da    PI: 5.1636
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PSME_00035515-RAgenomePRSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS436.61.8e-1333937602374
              GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfs 94 
                       ++lL+ecA+a+++  +  a++l++ l+e ++ +gdp++Rlaay++e+L ar + s+ ++yk+l++++ +   sse l+++++++ev+P++kf+
  PSME_00035515-RA 393 KSLLIECAKAIAD--NLDADNLITALKEVVNIHGDPIHRLAAYMVEGLVARKHLSGGHIYKILKCKQPT---SSELLSYMHILYEVCPYFKFG 480
                       689********97..6789*************************************************9...9******************** PP

              GRAS  95 hltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvakr 185
                       +++aN aI ea++ ++rvHiiDf+i qG QW++L+qa+a+R++g+p++RiTgv++p+s+  + + l+ +gerL+k+Ae+++vpfef++l    
  PSME_00035515-RA 481 YVAANGAIAEAFKDKDRVHIIDFQIAQGSQWITLIQAFAARQGGSPHVRITGVDDPDSEyaRGQGLNLVGERLSKLAESCQVPFEFHAL-PVF 572
                       ********************************************************999999**************************5.778 PP

              GRAS 186 ledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpre 278
                        +d+  e+L+++pgEalaVn+ lqlh+++desvs++++rd++L++vk+l P+vv++veqea++n+++Fl rf+e+l+yy+a+f+sl+++lpr+
  PSME_00035515-RA 573 GSDVYAEMLDIRPGEALAVNFPLQLHHMPDESVSTSNHRDRLLRMVKGLGPDVVTLVEQEANTNTAPFLPRFMETLSYYTAMFESLDVTLPRD 665
                       999****************************************************************************************** PP

              GRAS 279 seerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvS 371
                       s+er++vE+++l+r+ivnv+acegaer+erhe ++kWr+rl++aGFk++pls+++++++  +l+ ++++ yr+ e++++l+lgW dr L+++S
  PSME_00035515-RA 666 SKERVNVEQHCLARDIVNVIACEGAERVERHELFGKWRSRLTMAGFKSYPLSSHVNSTIGVVLSSYNQN-YRLVEKHEALYLGWLDRDLIVAS 757
                       *******************************************************************66.*********************** PP

              GRAS 372 aWr 374
                       aW+
  PSME_00035515-RA 758 AWK 760
                       **8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098564.444366741IPR005202Transcription factor GRAS
PfamPF035146.3E-131393760IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 760 aa     Download sequence    Send to blast
MSLASACQDS MRGDDNSYRT SPWFHGNLPV VPEQCTSGEI LNLQWRNTFR SCSTDLSPKQ  60
DGNFGIFHTS TTSERIGGTP KMIDQRSPIS PLSPQGTGSD GLPQTSQSQR FYCSERNQMS  120
DDLIQNSSHN DGSFNDQRYI HESFPFNTEH SHESSICIQS SSGGSPMSSQ HSQSYSCDSR  180
YFQSPEDAAD PVGNGYSGNE QPAASKFLEQ IETALLGPDG DFPADMDYVY GESNSEWSLE  240
AWSDFNDILD QTCNLGYPQT NNSRAPDNLQ QLPNRNPGYP QTNRADSSRV PDNLQQLPNH  300
NPGYPQTNKA DSSRSPDNLQ QLPNHNPGYT QTNKANSSRS PDNLQQLPSH GDRNVKVETV  360
NEVNFKTEHC SPSNSHEEQH DMEDLKISQG DVKSLLIECA KAIADNLDAD NLITALKEVV  420
NIHGDPIHRL AAYMVEGLVA RKHLSGGHIY KILKCKQPTS SELLSYMHIL YEVCPYFKFG  480
YVAANGAIAE AFKDKDRVHI IDFQIAQGSQ WITLIQAFAA RQGGSPHVRI TGVDDPDSEY  540
ARGQGLNLVG ERLSKLAESC QVPFEFHALP VFGSDVYAEM LDIRPGEALA VNFPLQLHHM  600
PDESVSTSNH RDRLLRMVKG LGPDVVTLVE QEANTNTAPF LPRFMETLSY YTAMFESLDV  660
TLPRDSKERV NVEQHCLARD IVNVIACEGA ERVERHELFG KWRSRLTMAG FKSYPLSSHV  720
NSTIGVVLSS YNQNYRLVEK HEALYLGWLD RDLIVASAWK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A4e-583967608375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT1100350.0BT110035.1 Picea glauca clone GQ03215_B19 mRNA sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010270168.10.0PREDICTED: scarecrow-like protein 21
TrEMBLA0A0B4U8K10.0A0A0B4U8K1_PINRA; SCL10
STRINGVIT_12s0057g00560.t010.0(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G48150.21e-180GRAS family protein